logo dekostile.ru DEKOSTILE.RU | Личный кабинет | Контакты | Доставка товара

Домкрат Autoprofi DG-12 12т 415мм

Толстовка


Теплая удлиненная толстовка с капюшоном.
Цвет: коралловый.

2040 РУБ

LacyWear dg-8-bea похожие

Подробнее

Толстовка


Теплая удлиненная толстовка с капюшоном.
Цвет: ярко-розовый.

2040 РУБ

LacyWear dg-6-bea похожие

Подробнее

Толстовка


Теплая удлиненная толстовка с капюшоном.
Цвет: зеленый.

1599 РУБ

LacyWear dg-7-bea похожие

Подробнее

Толстовка


Теплая удлиненная толстовка с капюшоном.
Цвет: голубой.

2040 РУБ

LacyWear dg-4-bea похожие

Подробнее

Туника


Летнее платье с цветочным принтом. Модель выполнена из хлопкового материла. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: зеленый, красный и др.

Рост девушки-фотомодели 170 см.

1140 РУБ

LacyWear dg-72-bea похожие

Подробнее

Домкрат Autoprofi Dg-08


Максимальная грузоподъёмность: 8, Высота подъёма: 405, Высота подхвата: 200, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1386 РУБ

Autoprofi dg-08 похожие

Подробнее

Домкрат Autoprofi Dg-02


Максимальная грузоподъёмность: 2, Высота подъёма: 308, Высота подхвата: 158, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

871 РУБ

Autoprofi dg-02 похожие

Подробнее

Домкрат Autoprofi Dg-16


Максимальная грузоподъёмность: 16, Высота подъёма: 445, Высота подхвата: 225, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1948 РУБ

Autoprofi dg-16 похожие

Подробнее

Домкрат Autoprofi Dg-06


Максимальная грузоподъёмность: 6, Высота подъёма: 405, Высота подхвата: 200, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1030 РУБ

Autoprofi dg-06 похожие

Подробнее

Домкрат Autoprofi Dg-20


Максимальная грузоподъёмность: 20, Высота подъёма: 440, Высота подхвата: 235, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

2569 РУБ

Autoprofi dg-20 похожие

Подробнее

Домкрат Autoprofi Dg-12


Максимальная грузоподъёмность: 12, Высота подъёма: 415, Высота подхвата: 210, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1746 РУБ

Autoprofi dg-12 похожие

Подробнее

Домкрат Autoprofi Dg-04


Максимальная грузоподъёмность: 4, Высота подъёма: 350, Высота подхвата: 180, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1049 РУБ

Autoprofi dg-04 похожие

Подробнее

<SEC-DOCUMENT>0000000000-13-010469.txt : 20130509 <SEC ...

Q))[$DW@23^)) M/(DG\22>Q)-X$D_B^?_R:/\_LOC;9]/PR9E1RV[G@WK?@1BM#&/R[\FMTSYU MFG>2EA-:84DZ/9-_L_(876I<Z_OY&%BF;E9<&_O93>R0 ...

Warning: set_time_limit() has been disabled for security reasons in ...

*Nnp UYK@a0 P53T :5uc gJaqJ f<'T -d&@A >y_y )LCN Q'dg UkZMf 3"pn 4Qad ...... ARQRM :5T% kHI;, JQk,3 )PqIK /gr(Y T%4s +eTY= U724Zb SzacaCv kv+H r. .... Js)j V#%C %fWXJ V[S8Z #:RU CN$9m %Q:M O18)e o'aNn S 1M 0voJ kNa;A ...

1 Council of the District of Columbia COMMITTEE ON ... - DC Council

1 окт. 2018 г. - Courtyard. Project Completed $1,501,000 $1,503,400. $0. $0. DGS. Finalizing ...... 00026181 Jackson,Rita Ann. 00026415 Davis ...... Page 724 ...

Case No COMP/M.4439 – Ryanair / Aer Lingus REGULATION (EC ...

27 июн. 2007 г. - RNS, SCQ as well as SNN where only the Merging Parties are based). ...... 724 Even though both Aer Arann and Ryanair operate currently ...

1910 Abstract – Supplement for Kansas - Census Bureau

Retnrned as Snn in 1000. l,:US. 10,403 ...... Dg Troy city .••..••.•. ...... 726. 756. 1,017. MO. 1,296. 505. 004. 2,432. 769. 547. 6S:B. 484. 1,117. 481. 1,611. 770. 854.

ContentBackupHistory.xml

... atYuD585/0r/pyz/oP+if56j7S8B/DHwH4vh1L7BB5H724+y3EF0P8APr1r2Mrr ...... wAEDNSabwJ+0HYS+fs/4WPb6nFn/UfZ7zSdIs7XHv8AbLO8PHb1r8Sf+Dg+ ...... /wTrEM3w916/sNN+wQjQvFEX2j/AKd/+EXvbPr14sPsn/1+tTalD+546/n/AID1/ ...

Summary Technical Report of Division 14, NDRC. Volume 3 ... - DTIC

strument and Its I'se, A. von Hippel, D. G. 14-225. Jelatis ...... KL-724 Design Considerations for Directional ...... ration* of the Project Tnl» Shop, Harri.snn, N. J..

TBLASTN 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F ...

... 649 + DD S + + ++ + DG ++ NNNNNN++NNNNN Sbjct: ..... 724 NN + +N + ++ I + + Q + Q Q +Q ++ +K Sbjct: 889 ..... 635 + E SP + + +SNN + + + + Sbjct: 724 ...

Common and Unique Gene Expression Signatures of Human ...

8 июл. 2004 г. - TMC724, a strain of avian origin, could not be classified by any one of these ...... CXORF6. 2.55. KIAA0286 protein. KIAA0286. 2.43. Stannin. SNN ..... Cooper, A. M., D. K. Dalton, T. A. Stewart, J. P. Griffin, D. G. Russell, and.

MJ Tannenbaum - Phenix.bnl.gov - Brookhaven National Laboratory

Letters, 14, 724(1965); Michael J. Tannenbaum, thesis, Columbia University, Nevis-132 ... M.J.Tannenbaum, W.E.Cleland, D.G.Ryan and D.G.Stairs, Observation of .... Energy Distribution from √sNN=130 GeV Au+Au Collisions at RHIC, Phys.

Subunits of RNA polymerase II in Giardia lamblia - The Journal of ...

6 мая 2003 г. - Thompson, J. D., Higgins, D. G., and Gibson, T. J. (1994) Nucleic Acids Res. ..... 724 V S R I L N Q A R D N A G R S A E H S L K D S N N V K Q ...

USS Louisville (SSN-724) - Wikipedia

USS Louisville (SSN-724), a Los Angeles-class submarine, is the fourth ship of the United States Navy to be named for Louisville, Kentucky. The contract to build ...Не найдено: dgРубашки - Modnaya.rumodnaya.ru/shop/lacywear/3-1/3/9/rubashki.htmСохраненная копияМодель: DG(340)-SNN. Цена: 999 руб. ... сиреневыйРост девушки-фотомодели 180 см. Модель: DG(339)-SNN ..... Модель: DG(724)-SNN. Цена: 1350 руб.

2480 S. GRANDE BOULEVARD GREENSBURG, PA 15601

8 мая 2017 г. - JOHN S. AUSTIN III, NHA (JAUSTIN@CO.WESTMORELAND.PA.US). 2480 S. GRANDE BOULEVARD. GREENSBURG. 1 - 724 - 830 - 4000.

Targeted epigenetic editing of SPDEF reduces mucus ... - EpiPredict

23 дек. 2016 г. - band Noord-Nederland SNN-4D22C-T2007. D. Goubert is ... and designed research; J.S., D.C.R., M.W., D.G., and T.P.J. performed exper- iments; J.S. ... Science 351: 720–724, 2016. doi:10.1126/science.aab2956. 3. Brenet F ...

STOCKHOLM 1.0 #=GF ID Usher_TcfC #=GF AC PF17271.1 #=GF DE ...

DG..FSMSIYRNAAYGKSCTSADAGq. ..... NEGISSEIKTGTG- G5ME46.1/313-724 -AQTQWFIQGGQEDTGD........kASHYDGETVMAAGFRTGLRKNISLTEGI.

From Knowledge Transfer to Competence Building in Euratom: from ...

18 мая 2012 г. - •4 – Towards lifelong learning and borderless mobility (DG EAC) ..... including Fission €355m;Fusion € 709m; JRC € 724m. Funding for ITER ...

Studies of azimuthal dihadron correlations in ultra-central PbPb ...

Azimuthal dihadron correlations of charged particles have been measured in PbPb collisions at sNN−−−√ = 2.76TeV by the CMS collaboration, using data from ...

Multiplicity dependence of jet-like two-particle correlation ... - Hal

15 янв. 2015 г. - sNN = 5.02 TeV collected by the ALICE detector in 2013 are used. ...... 724 (2013) 213–240. [5] G. Aad, et al., ..... A.G. Knospe dg, C. Kobdaj ah,dd, M. Kofarago ah, M.K. Köhler cm, T. Kollegger am, A. Kolojvari ds,.

Eclipse Community Forums: GEF » Nested Layout with ...

26 апр. 2005 г. - /wDVXH+SNN/N/wBlP/il8Qu/5VJ+Xv8A1av+ni5/6q4/yRpv5v8Asp/8UviF ..... /E9A7RPIPmHTdDg0YvaSxGbQ724uhLKrLPpQ0+K aFI/SIeN4tOe .... Your example has a cycle in it, so I'm not sure DG is the best thing for you.

Publications - Институт ядерной физики и технологий - МИФИ

Philosophical Magazine, 2018, 98, 8, 710-726, 10.1080/14786435.2017. .... Effect with Event Shape Engineering in Pb–Pb collisions at sNN=2.76 TeV. ...... YuA Nepochataya OE Rudik DG Shakirov AV Simakov GE Sosnovtsev VV Vasin AA ...

Inflammatory Bowel Diseases

Ina K, Binion DG, West GA, Dobrea GM, Fiocchi C. Crohn's disease (CD) mucosal T-cells are resistant to apoptosis. ... Travis SPL, Jewell DP. ... 1994;106:A728.

Building Activity Report - City of Birmingham, Michigan

8 мар. 2017 г. - DG RESIDENTIAL SALES LLC. (248) 250 2545. 02/02/2017 ... 02/23/2017. 700 ANN ST # 1. WINDOW ...... 11/29/2017. 724 ANN ST. WINDOW ...

Model Bus Zone - Oxford Die-Cast 1/76 Model List

Model Lists Oxford Die-cast - All 1/76 Scale Models A list of 1/76 scale models compiled by Peter Harrison As at 6 january 2017

Tight-Binding Approach to Computational Materials Science ... - DTIC

University Microfilms Inc., 300 Morth Zeeb Road, Ann Arbor, Michigan 48106. CODEM: MRSPDH ... Telephone (724) 779-3003. Fax (724) 779-8313 ...... P. D. Godwin, A. P. Horsfield, D. G. Pettifor, and A. P. Sutton, Phys. Rev. B 54, 15776 ...

Diario de la marina - dLOC Home

Related Items Preceded by: Noticioso y lucero de la Habana Succeeded by: 7 días del Diario de la marina en el exilio

References - EMIS

120, Boulware, D. G. and Deser, S., “String Generated Gravity Models”, Phys. Rev. ...... 726, Steinhoff, J., “Canonical formulation of spin in general relativity”, Ann.

High-pT Physics in the Heavy Ion Era by Jan Rak

[194] S. D., Drell and J. D., Walecka, Ann. Phys. ...... [403] M. J., Tannenbaum, in Particles and Fields-1979, edited by B., Margolis and D. G., Stairs (American Institute of Physics, New York, 1980), Vol. ...... [724] F., Arleo and D., d'Enterria, Phys.

PHP code - 11 lines - codepad

Output: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 ...

With the proper - CDC

Ann New York Acad Sci 1995:754:278-88. 35. ...... Fish DG, Ampel NM, Galgiani JN, Dols CL, Kelly PC, Johnson CH, et al. ..... Science 1995;270:724-7. 2.

Портмоне, кошельки и косметички // Витрина брендов: Женская ...

Блузка. Модель DG(752)-SPL · Блузка. Модель DG(747)-SPL · Туника. Модель DG(728)-SPL · Блузка. Модель DG(731)-SPL · Майка. Модель DG(51)-MAL.

' - b: 2

... cb'-'nb-n-Tm (leben) Bi-cnb-n-Tm (leben) Hp-rnb-Tm (leben) Snn-cnb-n-Tm ... 40, 14 und Tf. 724; КО 705 = Gutbub, КО, 333, 2. cnb-tw-n-dg.fi "Bei dessen ...

Sheet1 - Brentwood Academy

... Column715, Column716, Column717, Column718, Column719, Column720, Column721, Column722, Column723, Column724, Column725, Column726 ...

Information About... - Federal Direct Loans - U.S. Department of ...

w Y Ta F?"{G D(-4\h .4Kh j.T` -4Oh O =W ky:R )KG1AO nRtO 4'~8o` SXPIg xc. ...... 0/StructParents 245/Tabs/S/Type/Page>> endobj 724 0 obj < >stream ,TIN ...... `'j' [':3 `+\# w0vg sNN\vv :0""\x%\x% Xm)J kLaqy Y-V>& :0g:V a(=} >"bJQyZ DOrt ...

52610SNDP01; запчасти для легковых авто, грузовиков и ... - Фарпост

... 52610-SND-P01, 52610-SNE-P03, 52610-SNL-T03, 52610-SNN-Y.. ..... 15:31, 1 ноябряFEAS Автозапчаст... 2 724₽. Амортизатор газомасляный KYB (R) KYB .... Заднее Амортизатор газовый задний (HONDA CIVIC 06- sedan) DG.

Introduction to Sedimentology

33, pp. 728–738. Chanda, S.K. and Bhattacharyya, Ajit. 1974. Ripple-drift cross-lamination in tidal deposits: example from the ... Society of Economic Paleontologists and Mineralogists, Spl. Pub. no. ... Curray, J.R. and Moore, D.G. 1971.

SPL 728 - MiTek

Piła jednotarczowa "SPL 728”. Piła produkcji największego skandynawskiego producenta maszyn do produkcji wiązarów i domów drewnianych - szwedzkiej ...Не найдено: dgOxidative Damage to Nucleic Acidshttps://books.google.ru/books?isbn=0387729747 - Перевести эту страницуMark D. Evans, ‎Marcus S. Cooke - 2009 - ‎ScienceJohnson DG, Ohtani K, Nevins JR. ... J Mol Biol 1995; 249:714-728. ... on the binding of the transcription factor Spl to its cognate target DNA sequence (GC box).

Muscular Dystrophy: New Insights for the Healthcare Professional: ...

Neuromuscular Disorders, 2012;22(8):728-34. ... are characterized molecularly by hypoglycosylation of a-dystroglycan (a-DG). ... Electrophoretic mobility shift assay (EMSA) revealed binding sites for the Spl, Etsl and GATA transcription factors.

Long-range angular correlations of π, K and p in p–Pb collisions ... - fulir

19 авг. 2013 г. - ALICE Collaboration / Physics Letters B 726 (2013) 164–177. 165 along the longitudinal ... sNN = 5.02 TeV, are used in the presented analysis.

AMP-Activated Protein Kinase and Sirtuin 1 Coregulation of Cortactin ...

Br J Pharmacol. 1996; 118 :720–726.CrossrefMedlineGoogle Scholar; 31. ... Towler MC, Hardie DG . AMP-activated protein kinase in metabolic control and ...

A cross-selection instance algorithm

SNN is much more complex and the computational time ..... 724. J. Zhai et al. / A cross-selection instance algorithm. Fig. 3. The curves of testing accuracy on the 3 artificial data ..... [24] R.O. Duda, P.E. Hart and D.G. Stork, Pattern classification.

Got 4907 bytes response, method=default Response decode error Exif ...

dg 2=kiV f|+3 =:~54 /V'nI= *X3o\ F8NS| "B7 iLd, aW9\ T**w w7P8 S*D6 @_cf# #+O$ T n? ..... gemP $`Aw h$an"' +8MI $lvm^ 9?7 rPJ+ti IBi% ANI+5 >UA\d B724 NEs3 "F02 ~s^mY4 ,x`q ...... +MRk+o rF~Pw}zV ;c*G _x"mA Kq++66 sNn* ?'Ppk I!#l ...

PDF(50MB)

30 окт. 1993 г. - Ann. Bull., Hiroshima Univ., Taishaku-kyo Site Res. Cent. ...... 724 KONTA Tadashi, SAITO Kazuo, WATANABE Yuji and OKADA Hisatake (1986): K-Ar ...... 1, Figs. 1-3. (dg(1jl.JIil:O) -*~JI~ J:: '?. 7 jJ ~:./ t) 0) Slll!rfl::::fiiJ~ggt±:D.

SMW728 WCDMA/LTE Tablet + Bluetooth/BLE and DTS/UNII a/b/g/n ...

SMW728 WCDMA/LTE Tablet + Bluetooth/BLE and DTS/UNII a/b/g/n/ac RF ...... dBm mW Rear Edge 1 Edge 2 Edge 3 Edge 4 Front Rear Edge 1 Edge 2 ...... Location Ratio (SPLSR) between pairs of simultaneously transmitting antennas:.

Long-range pseudorapidity dihadron correlations in d ... - DSpace@MIT

3 июн. 2015 г. - G. Webb c, L. Wen f, G.D. Westfall aa, H. Wieman x, S.W. Wissink p, R. Witt au, Y.F. Wu h, ... sNN = 200 GeV are reported as a function of the.

Dg 72 bea. Model Bus Zone - Oxford Die-Cast 1/76 Model List

Model Lists Oxford Die-cast - All 1/76 Scale Models A list of 1/76 scale models compiled by Peter Harrison As at 6 january 2017

Proceedings of the DAE Symposium on Nuclear Physics

Determination of hexadecapole deformation for $^{160}$Gd nucleus using ...... \gamma$ interactions from compact stars., Avijit K. Ganguly,Manoj K. Jaiswal, 724, pdf .... Search for light-by-light scattering in PbPb collisions at \SNN 5.02 TeV, ...

cpcb.nic.in

Notice: Undefined index: language in E:\XAMPP\htdocs\cpcb\openpdffile.php on line 12 NewItem_158_MSIHC-REPORT.pdf%PDF-1.6 %âãÏÓ 480 0 obj > endobj xref ...

30th Benelux Conference on Artificial Intelligence - bnaic/benelearn ...

9 нояб. 2018 г. - Ann Nowé: Towards explainable reinforcement learning ...... https://www.dgs.pt/portal-da-estatistica-da-saude/diretorio-de-. 119 ...... 724–731.

infostar.tistory.com

ALZ aד aŽ=—Þd³q¡k9m€-Gµ®Õ‰ùS ] ½±L±q£V %+é¶Øaá 5’¨o²W- À©XùØ0]_ø ¼Ñ¿ x ÜÑ.»-åf5a ížÌ¢|n7íˆëÜ þl*¬öƒ Åœ ...

dbofs - Tides and Currents (NOAA)

Snn, snn. Water temperature at forecast projection time of nn hrs. Tnn, tnn. Table 3. Acceptance ...... Modeling, ASCE, 724-743. Locarnini, R. A., A. V. ...... D-d 22.5 dg 24h 87600 -1.774 5.996 5.728 0.0 98.9 0.0 0.2 0.0. 0.92. DFC-dfc 22.5 dg ...

NCBI CDD Conserved Protein Domain leuS_bact

7 окт. 2014 г. - DG CCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLD.[1].WPDTVKT 238 ..... SPLMRNQAWVNIVKD.[2].H.[2]. ..... YEA WPVYDETKLVDDE VEIVVQL 750 gi 6919977 728 NYLNIFKPFIIILSPYAPHLAEELWEYIG.[1].LP.[3].

A2 - CT Scans - Council for Medical Schemes

724, C40.3. 725, C40.8. 726, C40.9. 727, C41.0. 728, C41.1. 729, C41.2. 730, C41.3. 731, C41.4. 732, C41.8. 733, C41.9. 734, C43.0. 735, C43.1. 736, C43.2.

Indian Railway Station List with Station Code and Number of Trains ...

5 июн. 2018 г. - 726, Bolarum Bazar, BOZ. 727, Bolinna Doaba ..... 1180, Dindigul Junction, DG, 40. 1181, Diphu ...... 3955, Sonegaon, SNN, 1. 3956, Songadh ...

(The Statistician): 1980–1989 - Index of files in - University of Utah

[724]. Ann [430]. Annick [756]. Announcement [395]. ANOVA [478]. Answers [785]. ...... [207] D. G. Altman and J. M. Bland. .... plications of Econometrics, by D. G..

Service/repair manuals owners/users manuals schematics

Service manuals, repair manuals, owner's manuals for Panasonic Sony JVC Samsung Sharp Pioneer Sanyo Hitachi Philips Kenwood LG Toshiba & others

Nw6, vvJ, Q68, JG3, y41, BG7, 1Cv, LnQ, 0Yz, 7l8, lUa, 76Z, G7o, 8s4 ...

... KO2, XIE, LIA, Hcm, i97, 81m, wWb, 01d, 4GO, 724, 1q6, Uuh, Bx9, HH2, 506, .... 02T, 8G3, r6L, bS7, k50, 5Px, 89A, r08, kzS, 2Hk, 278, fx7, 1II, sNN, 7qj, gWo, ...

Adaptation to dislodgement risk on wave-swept rocky shores in the ...

23 окт. 2017 г. - 25, CZE724, 2007.282, 2030.997, 199.544, SNN, 3, 2.5, NA, 724, 0.873, 0.332, 0.165, 0.776, 0.347, 0.176, 0.815, 1.186, 1.035 ..... Reid DG.

Aristophanous Kōmōdiai ennea meta scholion pollōn palaiōn kai pany ...

:bz 4.8 (47وم region av6يعية mdb6xم r dgdb0تواth 8r04 724xصومر716هء ح 68 m ... و grax o 88 snn Lywgrax • 4vgrgy ويول ح وO xنn Mصه عوعوع »1 و8 r sn3Xppsح:3 ... 3و4 twor axut 88 ةhو% نر %x20 عمx 20x عمCaobx/يy gty dg: 20x عمxصويرة ح ع 6 ...

www.state.ky.us

Drawdown Group Codes Funding Source Codes Entitywide Project Codes Summary VEZ** VF0** VF1** VF2** VF3** VF4** VF5** VF6** VF7** VF8** VF9** VFA** VFB** VFC** VFD**

Femtoscopy with identified charged pions in proton-lead collisions at ...

28 дек. 2017 г. - sNN = 5.02 TeV with an integrated luminosity of 28 nb. −1 ...... S. K. Chan,58 Y. L. Chan,62a P. Chang,170 J. D. Chapman,30 D. G. Charlton,19.

Ελλάδα: Τελευταίες ειδήσεις, νέα και έκτακτη επικαιρότητα (σελίδα 724 ...

2015 - 2018 D.G. Newsagency S.A. CNN name, logo and all associated elements ® and © 2015 Cable News Network, Inc. All rights reserved. CNN and the ...

PDF Print - APS Journals - American Phytopathological Society

Sundaraj, S., Srinivasan, R., Culbreath, A. K., Riley, D. G., and Pappu, ..... and Hst (29) and nucleotide-based statistics Ks, Kst, and Snn. (28,29) ...... 11:715-724.

United States Imports of Merchandise for Consumption: Commodity by ...

... 9 27707 4 8 2433 5 3 624 687 707 и" 4095 8814858145 32033065 O 724 22 3 88 ... ‚Н Ü Н Т T Н А N С 752Н 0 V 0» V U o i U '« ш Р A N N 8 С Е А Р w 0 88 ... N P P E E 9 DG A .dn мы А Т N C N N N R N I N 9 N E nu me R S A А S I I I U О ...

FAR INFRARED OPTICAL PROPERTIES OF Sn%?S3 - Science Direct

Orthorhombic Sn”Snn'SS3 is a type I mixed valence”' ternary sulphide ... D. G. MI.AI) and H. R. CHAUDKAS~KHAK. Table I. Frequencies (cm- I unit) and damplng ... 724. I oscillator expressionC4' r?(w) = E,. 6X.6. 0.030. 0.02'). I0X.I. 0.06 I.

Temporary List - Ministry of Defence - Sri Lanka

51, Army, 1049, DG THILAKARATHNA RSP, O/65361, SLE 9 SLE SER, D.G.P.W .... 2059.87, Lindsay B.M.V 724,Gall Rd,Colombo 3 ...... 1266, Army, 2264, WEJEWARDANA DNR, S/319154, SLLI 1 SLLI SER, SNN WIJEWARDANA, F ...

Great Lakes Coastal Wetlands Monitoring Plan

Cranbrook Inst. Sci. Bull. 59 & Univ. Mich Herb. 724 pp. Voss, E. G. 1996. ...... Wilcox, D.A., J.E. Meeker, P.L. Hudson, B.J. Armitage, M.G. Black, and D.G. Uzarki. ...... Project Completion Report, Great Lakes Science Center, Ann Arbor, Mich.

Фрагмент каталога выставки «Евразия-2018 - РКФ

6 мая 2018 г. - АВСТРАЛИЙСКИЙ КЕТТЛ ДОГ / AUSTRALIAN CATTLE DOG. Кобели / Males: ...... OLA724. RKF 5154856, , PIV 1. Класс Ветеранов / Veteran class. RKF 2329731, , WDF 342 ...... RKF 4271372, , SNN 266. RKF 4274668 ...

ASHG 2012 Abstracts - The American Society of Human Genetics

4 июн. 2012 г. - University of Michigan, Ann Arbor, MI; 2) Neurology, University of Michigan, .... The three patients with GD all had hepatomegaly and cardiac ...... T: (303) 724-2370 F: (720) 777-7322 E: gunter.scharer@childrenscolorado.org.

РКС Компоненти

72/ 720 721 722 723 724 725 726 727 728 729 72A 72B 72C 72F 72H 72J 72K .... ANE ANF ANG ANH ANI ANJ ANK ANL ANM ANN ANO ANP ANQ ANR ANS ..... D-C D-D D-E D-F D-G D-H D-I D-K D-L D-M D-P D-Q D-R D-S D-T D-U D-W ...

Matchfakta

Banpoäng: PT+DG 3/4, AM+HL 0/4, BoT+GB 0/4, HG+MW 1/4. ... Lars-Erik Carlsson 766, Torbjörn Jansson 724, Ann-Louise Lindström 724, Mari Eriksson 694, ...

PK 1._obertura_de_la_opera_guillermo_tell.m4a qwww# @pw ...

Cg6h 9dD{ flG$ oaMH '~rC5 Ku}% :hFHf J2!j;e a4uW A>)] +-GD D@}c $U!$&>'a ...... ](Pj M*rOc v[8e M'+d i/snN ogABD >q6gC ('Z} IwJ@ TgBZ qlQ_ "ntH= N6??

Neuroprotection in Perinatal Hypoxic-Ischemic Encephalopathy ...

1 окт. 2013 г. - SNN selective neuronal necrosis .... Ann Neurol 1999; 45: 724–35. ...... [261] Subirós N, Del Barco DG, Coro-Antich RM Erythropoietin: still on ...

UCLA Previously Published Works - eScholarship

1 июл. 2015 г. - sNN = 200 GeV. L. Adamczyk,1 J. K. .... P. Tribedy,49 S. K. Tripathy,14 B. A. Trzeciak,11 O. D. Tsai,6 T. Ullrich,3 D. G. Underwood,2 I. Upsal,30 ... sNN = 200 GeV are reported as a function ..... B724, 213 (2013), 1305.0609.

[Fuego] [PATCH 2/3] dbench4: add source code files

4 апр. 2018 г. - Dg!85~GwbA|-;ie5}WG_#s_vr`E8uu_R| z)<B}o>WC7>`fFshO`%f!YUu5TNq1EmNI~@^qEo7 ...... cVw at sdR4jIgBn9b=Z>EOaLlC(Aw7dcjoacsyqL85) zk^1%sNN!{ ..... iXIdb7$VhB at S1$D0{#i+CcCac1j+?%ok)Y724^{ ...

December 2008 - Nasdaq Trader

460, GD, 9,581,549, 9,934,183, 19,515,732, 2,228,556, 21,744,288, 54,787,678 ...... 724, CRL, 5,151,354, 5,383,766, 10,535,120, 1,179,278, 11,714,398 ...... 1721, SNN, 506,099, 1,565,426, 2,071,525, 131,793, 2,203,318, 4,336,448, 11.70% ...

Tanzania HDC Launch Participants - Government - Health Data ...

BlavkeD NA DG NLE DAY 26 (22 ( 9 ko pac n tatovtr. 13. CARAKA MADI ETA/ AS .... Dafa Peh, Lut724 ILSIA. James Mwanzo Sfo -Dur fraHaM LYL 724 (LSI J.

Fluid Power and Motion Control

(SNN), was able to capture the dynamic behavior of a load sensing pump over a large ...... (17) Paygude, D. G., Vasudeva Rao, B. and Joshi, S. G. (1985), “Fluid ...... 724. 184. 102. 414. 1665. kJ. DC. 259. 4.8. 392. 129. 229. 1013. kJ. Relative.

Nairobi Children'S Court - Kenya Law

11 июл. 2017 г. - ... L. K. K; CC 15/2011 F. M -VS- D. K. N.; CC 16/2011 P. K. –VS- S. N. N. .... CC 1319/2011 D. G. -VS- F. M.; CC 1325/2011 C. N. M. -VS- P. M. M. ...... CC 769/2011 M. L. O. - Vs - R. S. & J. A.; CC 724/2011 F. G. - Vs - S. M. ...

Ann St, Stroudsburg, PA 18360 - Who owns property on this street ...

Find out who lives on Ann St in Stroudsburg, Pennsylvania. We found 67 ... We found 67 addresses for Ann St, Stroudsburg, PA 18360. We found ..... 724 Ann St

University of California, Berkeley – Nuclear Science and Security ...

... J.E. Kinnison, L. Kirsch, A.C. Larsen, T. Lauritsen, W. Reviol, D.G. Sarantites, .... of low-momentum direct photons in Au + Au collisions at √ sNN=200 GeV” Phys. .... Low-Background Facility”, Nuclear Instruments & Methods A 724 (2013) 47- ...

Commander, Submarine Force, U.S. Pacific Fleet > SUBPAC ...

USS Louisville (SSN 724). Submarine Squadron 7. Pearl Harbor, HI. Home · About · Leadership · News · Contact. prev. Commander, Submarine Force, U.S. ...Не найдено: dgField & Streamhttps://books.google.ru/books?id=xSnYdazgUqgC - Перевести эту страницуТом 85, номер 10 - ‎Журнал... Elmer Keith, Jack O'Connor, Warren Page, 001 724, Jamestown, Tennessee 38556 ... 0 Exotic Game In their native habitat _ _ “ Ph: ode-dg'zliioagg ' c°plém§$'mA ... Send 22.000 acres of private land In snn .innn M. ~eiegA-W. fie - for free ...

НАУКА МИСиС 2014

Тел.: 8-495-724-75-94; 8-499-638-45-17. E-mail: ...... Kozitov L.V., Bulatov M.F., Muratov D.G., Kuzmenko A.P., Popkova A.V. The formation of ..... ity asymmetry correlations in high-energy nucleus-nucleus collisions at sNN = 200 GeV. Physical ...

read access.txt - StockPickerUSA

Nr Company Name TKR Member of Cusip # 1: 111 Inc : YI: S: YI" 2: 1347 Ppty Insur : PIH: S: PIH" 3: 180 Degree Cap : TURN: SO: HHGP" 4: 1800Flowers.Com : FLWS

Indirizzi Strutture_30_12_2015 - Ministero della Salute

... 06, OSPEDALE OSTETRICO GINECOLOGICO SANT'ANN, 10771180014 ...... 01, 01, 2004, 01, OSPEDALE `SAN BASSIANO` DI BASSANO D.G., 00913430245 ...... 724, 110, MARCHE, 201, 201, 110002, PRESIDIO OSPEDALIERO UNICO ...

23rd Floor Post Mitigation Assessment - Board of Equalization

20 окт. 2008 г. - Services (DGS) with this letter summary report detailing BioMax's findings and ... PINOLE, CA 94564 • TEL£~RONE (510) 724-3100 • F~CSIMn,g'(51.0) 724·3145 ...... 115G Baybill Drive, Suite J00, Snn Bruno, CA 94066. '" lSl.

Next-generation Sequencing and Bioinformatics for Plant Science

microRNA156-targeted SPL/SBP box transcription factors regulate tomato ovary and fruit development. Plant J. ... C., Sunkar, R., Zhou, C., Shen, H., Zhang, J.Y., Matts, J., Wolf, J., Mann, D.G., Stewart, C.N., Jr., Tang, Y., et al. ... 146,716–728.

Measurement of $ K_S^ 0$ and $ K^{* 0} $ in $ p $$+ $$ p $, $ d $$+ ...

14 мая 2014 г. - S and K∗0 in p+p, d+Au, and Cu+Cu collisions at √sNN = 200 GeV. A. Adare,13 S. Afanasiev,32 C. ...... mesons differs from the nominal PDG value MP DG = 134.98MeV [53]. To match the ...... Rev. Lett. B 724, 213 (2013).

Advances in Protein Chemistry

... 210 (355), 224 Simonsen, D. G., 328 (453), 871 Simonsen, J. L., 337 (342), 369 ... Skim, A., 299 (308), 327 (309), 333 (309), 368 Skraup, Z., 309 (728), 311 (493, ... 61, 66 Sfirensen, S. P. L., 144 (26), 147 (26), 162, 300 (747, 750), 316 (744), ...

pre bid/proposal conference attendee register - City of Chicago

FHP/SNN. 8725 W. Higgins. Rd., Chicago, IL. 773-444-3474. 773-693-0064. Ken Brosseau. Bennett &. Brosseau ... 847-724-5400. 847-724-7306 ... DGS. 78 E. Washington. Chicago, IL. 312-744-0099. 312-742-4768. Kevin Laberge. CDOE.

Купить белую женскую рубашку в интернет магазине Lacywear в ...

Рубашка DG(75)-RNK. Рубашка. 2290 руб. 2544 руб. ..... Блузка DG(758)-SPL. Блузка. 2390 руб. 2656 руб. ... Рубашка DG(728)-TOP. Рубашка. 3290 руб.

Print Newsletter Project - Norfolk Anglers Club

Important: Date of next meeting - Monday, October 10th at 7pm Location: Teppanyaki Buffet & Grill 7525 Tidewater Drive, Norfolk, VA 23505 MEETING

autos consolidado - Afip

DG CHEVROLET. SEDAN 5 PUERTAS. CLASSIC ...... 724 FIAT. SEDAN 5 PUERTAS. IDEA ESSENCE 1.6 16V. 85.400. 90.800. 96.100. 106.800. 044. I. 05.

GRG 84/10 Index to succession duty 'Old Act' files - State Records of ...

26 окт. 2016 г. - Ann. 1-. liHIOB. Haey Ann. 111'18. BAriOII. Richard ?oreacre. 1047'1. IU.ft. Frederick. ,..,. lJAUGHTON ...... POii:D G OR'iB. - or:i. 10175 ...... :;724. 4497. 5886. 2:;27. 2016. 2966. 11~14. 10682. 3588. 125. 738. 6005. '* 16"53.

research output – january to december 2016 - iThemba LABS

Noncolela, S S Ntshangase, P Papka, D G Roux, O .... elliptic flow in Pb-Pb collisions at √sNN = 2.76 TeV. ...... status. Journal of Physics: Conference Series 724.

Publications LHCb – 08 Dec 2018 - CPPM - IN2P3

sNN = 5 TeV, R. Aaij et al., LHCb Collaboration, arXiv:1601.07878. 1 ...... decays at LHCb, R. Aaij et al., LHCb Collaboration, Phys. Lett. B 724. (2013) 36-45. 42. ...... D. G. D'Enterria, W. Da Silva, P. David, I. De Bonis, S. De Capua, M. De Cian ...

QUERY >UniRef90_UPI00032B0587 >UniRef90_UPI00042CAD21 ...

... >UniRef90_F1QC84 >UniRef90_UPI0003C2B724 >UniRef90_J9PCH1 ... iteration 1 SSSTTAASST N N S T A ANN A SN SNN TSN N ASA T N NN ... DG D GS D D D GS D DG GD G G DGD D E D N D ED DGG DQ GDDG D ...

Vast Neighbor Summary - NCBI

... 3AH1_B 6 tnanDLRNNEVFFISPSNN------TnKVLDKI---S-----------Q--------SEV ... hlnssnNFTGYFNISSKKN------FnKIITMN---S-----------Nk-------TQA 724 1T9F_A 2 ..... 138 4USO_A 51 TVSP--L-------D-G-------------SSEQAWILRS----Y---D----------- ...

spreadsheet here

... Column715, Column716, Column717, Column718, Column719, Column720, Column721, Column722, Column723, Column724, Column725, Column726 ...

2018-ufcc-agency-participation

... Column715, Column716, Column717, Column718, Column719, Column720, Column721, Column722, Column723, Column724, Column725, Column726 ...

1990 Census of Population and Housing: Population and housing ...

For definitions of terms and meanings of symbols, see text] e T 101 I spl't tracts/BNA' ` Н C ... __ 33 74 212 419 24 506 so - 35 298 Dg nar sneak English 'very weil' ... -_ 215 98 728 33 247 756 336 96 261 High school graduate (includes ...

thesis dedication for god web dubois vs booker t washington essay ...

21 нояб. 2018 г. - ... crnn coan etern collonclusiot/ase-:rynbmi0/dg/-724a>4hs.e/b/mar is-fol//dg/ .... serwyl>esrviceslexndon=howmcdg/mariting snn c thcollege ...

Kiwifruit Genome Database

... 435 DG LE+ + ++NS N EL + DL ITN NP+M+S+ ++VP +S +N K+ Sbjct: 380 .... 724 SL GS SGSN+GSN NGSSAAV EGTNM +D G+A K G G GSGSGSGS G Sbjct: 667 .... 555 S + + + ++ +L+S+SN PN SN SNN DMGSTTN+A TK +K Sbjct: 495 ...

arXiv:1309.5681v1 [nucl-ex] 23 Sep 2013 - inspire-hep

23 сент. 2013 г. - We report the beam energy (√sNN = 7.7 - 200 GeV) and collision ..... [29] T. J. Tarnowsky and G. D. Westfall, Phys. Lett. B 724,. 51 (2013).

RANDEK SPL 728 - WOOD TEC PEDIA

WOOD TEC VALUE. NEW: Calculate the market price of your RANDEK SPL 728 with WOOD TEC VALUE. Free, fast and independent! Value machine ...Не найдено: dgJBL SRX728S Dual 18" Subwoofer | Musician's Friendhttps://www.musiciansfriend.com/.../jbl-srx728s-dual-18-sub...Сохраненная копияПеревести эту страницу Рейтинг: 5 - ‎6 отзывовThe JBL SRX728S Dual 18" Subwoofer is built to deliver smooth, clean, accurate ... Sensitivity (1w @ 1m): 98dB SPL; LF Driver: 2 x JBL 2268H 18" Differential ...

01234563784 4 31 6 8 - Systemair

724 4 +2 6364' 55. 82 5 01 +0 .... VWXYZ[\]^ `aZ^bcZ ^defZ gZ^XcZ gZfYWh\Y`^dg `i^jklWmn o ... zh\ ZaZiYWgfWmn XWXYZ[dg gZfYWh\mc] gWm]jk`gZco.

Title Measurement of higher cumulants of net-charge ... - JOPSS

19 янв. 2016 г. - distributions in Au + Au collisions at √sNN = 7.7-200 GeV. Author(s) ...... (2006). [30] O. E. Barndorff-Nielsen, D. G. Pollard, and N. Shephard,.

Dividend History | NYSE dividend paying stocks

Dividend History | Yields, dates, complete payout history and stock information

Developmental plasticity of mitochondrial function in American ...

The effect of hypoxia on cellular metabolism is well documented in adult vertebrates, but information is entirely lacking for embryonic organisms. The effect of ...

New JBL line of powered speakers announced. | Serato.com

22 янв. 2015 г. - I take it with a grain of salt, but the spl numbers are crazy. ...... by any chance have you heard a properly powered jbl srx728 ? and if so, how ...

(PDF) Multiplicity dependence of pion, kaon, proton and lambda ...

Multiplicity dependence of pion, kaon, proton and lambda production in p-Pb collisions at √SNN = 5.02 TeV. Article (PDF Available) in Physics Letters B ...

http://www.nap.bg/document?id=11695

Вс, 30 дек 2018 09:28:00 GMT一覧表 - sakaokakyokura.hisyaku.comhttp://sakaokakyokura.hisyaku.com/index.html自動車 車両寸法 全長 全幅 全高 ホイールベース トレッド 最低地上高 室内長 室内幅 室内高 車両重量 車両総重量 乗車定員 ...

Medicago: BLAST2 result

14 дек. 2001 г. - ... 551 + +SNN +G+VP Sbjct: 671 DRIKTFDVSNNLLTGQVP 724 Score ... AT+ F N +++G GGFG VYK +L DGS+VA+K+L + G+ +F E Sbjct: 1290 ...

Шариковые рельсовые направляющие

Каретки SNN – Узкие нормальные низкие. 68. Каретки SKN – Узкие ...... R1651 724 20. H. R1651 793 20 ...... 2006/07/1.0/DG. Шариковые рельсовые.

Glass Systems and Solutions

8 янв. 2018 г. - PB. Satin Brass without Lacquer. 599. 728. 728. SB. Polished Nickel. 618. 618 ... SPL. Painted or Powder Coated. Primer. 314. 600. 600. PR.

20 - Search engine for life-science PDFs - Pubget

The ratio between the prompt ψ(2S) and J/ψ yields, reconstructed via their decays into μ+ μ-, is measured in Pb-Pb and p-p collisions at sqrt[sNN]=2.76 TeV.

http://www.nap.bg/document?id=11695

Пт, 28 дек 2018 06:17:00 GMT一覧表 - sakaokakyokura.hisyaku.comhttp://sakaokakyokura.hisyaku.com/index.html自動車 車両寸法 全長 全幅 全高 ホイールベース トレッド 最低地上高 室内長 室内幅 室内高 車両重量 車両総重量 乗車定員 ...

Каталог пользователей ВКонтакте » 485 000 001 - 486 000 000 ...

485 490 712 (Anna Dg) · 485 490 713 (Alees ... 485 490 724 (Ann Familia) · 485 490 725 (Балым Жамбыл) · 485 490 726 (Thiago Vieira) · 485 490 727 (Mr Xxl)

Dg 72 bea. Service/repair manuals owners/users manuals schematics

Service manuals, repair manuals, owner's manuals for Panasonic Sony JVC Samsung Sharp Pioneer Sanyo Hitachi Philips Kenwood LG Toshiba & others

equivalent dynamic model of distribution network ... - Research Explorer

Dynamic Equivalent Models of Distribution Networks with DG . 23. 1.4 Summary of Past Work . ...... Lately, Artificial Neural Network (ANN) has been used to develop a dynamic equivalent model of ...... 724-730, 2007. [45] R.-M. He, J.-L. Wang, ...

Multiplicity dependence of pion, kaon, proton and lambda ... - JYX

sNN = 5.02 TeV, measured by the ALICE detector at the LHC, are reported. ...... B 724 (2013) 213–240, arXiv:1305.0609 [nucl-ex]. [21] K. Dusling, R.

mic21 정보 | 다이빙 숍 mic21c<

다이빙 숍 mic21은 일본에서 고품질의 스쿠버다이빙 장비와 수중사진 장비를 저렴한 가격으로 판매하고 있습니다. 9개 매장이 ...

EST_File Track DataType binary ByteOrder 01 NumFrames 1239 ...

RD `(=Jt 5=#<P= o>%t 9=yA <724= `#<s ib=]/ =<6M '9)\ 6? ... ?R+t?hu*? (_5= <8@Z ]|?"q >HNV># <5*l wL=v K@O# a=3Q '>DG =H{M;o fff> ? ..... F<ca( ~5w>J{ Fz!>? 57= snN=zu x=1H zVR< /z=p? w=P: < ":=+ @bet U6=b =*%z 8'=yb,= e=|2 T^ ...

Ειδήσεις (σελίδα 724) - CNN.gr

2015 - 2016 D.G. Newsagency S.A. CNN name, logo and all associated elements ® and © 2015 Cable News Network, Inc. All rights reserved. CNN and the ...

Serdar Ortaç - Kolayca DJ-SNN.mp3 by Erostur recommendations on ...

Stream Serdar Ortaç - Kolayca DJ-SNN.mp3 by Erostur from desktop or your mobile device.

Pfam: MtrB_PioB - GenomeNet

... #=GF NC 20.60 20.60; #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq #=GF TP Family #=GF RN ...

Домкрат Autoprofi Dg-10


Максимальная грузоподъёмность: 10, Высота подъёма: 405, Высота подхвата: 200, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет

1275 РУБ

Autoprofi dg-10 похожие

Подробнее

Водолазка


Универсальная водолазка с длинными рукавами. Отличный выбор для повседневного гардероба.

Цвет: серый, белый

Рост девушки-фотомодели 180 см.

1540 РУБ

LacyWear dg-20-bea похожие

Подробнее

Домкрат Autoprofi Dg-04k


Максимальная грузоподъёмность: 4, Высота подъёма: 350, Высота подхвата: 180, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет, Поставляется в: кейсе

1154 РУБ

Autoprofi dg-04k похожие

Подробнее

Домкрат Autoprofi Dg-02k


Максимальная грузоподъёмность: 2, Высота подъёма: 308, Высота подхвата: 158, Тип домкрата: гидравлический, Конструкция домкрата: бутылочный, Количество уровней подхвата: 1, Набор: нет, Поставляется в: кейсе

910 РУБ

Autoprofi dg-02k похожие

Подробнее

Джемпер


Цветной женский джемпер с элегантной горловиной и короткими рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: бежевый, синий и др.

Рост девушки-фотомодели 180 см.

890 РУБ

LacyWear dg-59-bea похожие

Подробнее

Топ


Топ на классических бретелях, декорирован ярким принтом. Изделие придаст Вам летнее настроение.

В изделии использованы цвета: бежево-серый, коричневый, зеленый и др.

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

790 РУБ

LacyWear dg-176-bea похожие

Подробнее

Туника


Туника с длинным рукавом и капюшоном не только согреет в прохладную погоду, но и придаст женственности Вашему домашнему образу.

В изделии использованы цвета: бирюзовый, красный, желтый и др.

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

1040 РУБ

LacyWear dg-135-bea похожие

Подробнее

Джемпер


Цветной джемпер с круглой горловиной и рукавами 3/4. Модель выполнена из приятного трикотажа. Отлиный выбор для повседневного гардероба.

В изделии использованы цвета: черный, белый

Рост девушки-фотомодели 180 см.

1040 РУБ

LacyWear dg-37-bea похожие

Подробнее

Водолазка


Однотонная водолазка с короткими рукавами. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного и делового гардероба.

Цвет: бирюзовый

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

890 РУБ

LacyWear dg-158-bea похожие

Подробнее

Джемпер


Цветной джемпер из мягкого трикотажа. Отличный выбор для активного отдыха или занятий спортом.

В изделии использованы цвета: розовый, синий

Рост девушки-фотомодели 180 см.

1040 РУБ

LacyWear dg-42-bea похожие

Подробнее

Туника


Туника с длинным рукавом и капюшоном не только согреет в прохладную погоду, но и придаст женственности Вашему домашнему образу.

В изделии использованы цвета: сиреневый, голубой, желтый и др.

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

1840 РУБ

LacyWear dg-136-bea похожие

Подробнее

Блузка


Цветная женская блузка с небольшим воротником "стойка" и короткими рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: белый и др.

Рост девушки-фотомодели 180 см

1040 РУБ

LacyWear dg-1-bea похожие

Подробнее

Толстовка


Цветная толстовка с капюшоном и длинными рукавами. Модель выполнена из хлопкового трикотажа. Отличный выбор для повседневного гардероба или занятий спортом.

В изделии использованы цвета: серый, розовый, черный и др.

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

899 РУБ

LacyWear dg-139-bea похожие

Подробнее

Джемпер


Цветной джемпер с длинными рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: коричневый, бежевый и др.

Рост девушки-фотомодели 180 см.

1199 РУБ

LacyWear dg-57-bea похожие

Подробнее

Комментарии


#dg 72 bea #trytree summer autumn women two piece set casual tops shorts plus size plaid #стол скр 2 ясень ясень #конвектор finnheat ephbm15pr 1500 вт белый б у вмятины на корпусе #anime style super transformation toys robot car hero action figure kid #стенка гранд кволити кубика 6 568 бодега светлый темый #рубашка imperial #bl4018 xj #09 0505 28 00 #подвесной светильник odeon light drop 2905 1 #мини печь first fa 5045 4 black #ps91 285 35 r20 104y #книга утраченных сказаний часть 1 #сулл д эйзенхардт к простые правила как преуспеть в сложном мире #a1102ap 2ab mark #туника imperial #подвесная люстра lamp4you e4 07 h lmp o 20 #zs 0700 млечный путь #лесной бальзам ополаскиватель дуб и пихта при кровоточивости десен 400 мл #sr 7011 chrome #todorova clear zircon winter snowflake chain link bracelet fit wedding bracelets #holy land #gt790 imperial #пл тип 1п 32x50 #mat trunk for lada xray 2015 without trim floor 1 pcs polyurethane #anita scharmach miłość na gigancie #storm trooper jedi order imperial clone wars coffee 501st legion rebel imperial #далай лама десмонд туту книга радости как быть счастливым в меняющемся мире #2252 1t #плоскогубцы кобальт 647 086 пассатижи 160мм cr v 1шт подвес #8713 #kr 8520d #пк dell optiplex 5060 micro i5 8500t 2 1 8gb 1tb 7 2k uhdg 630 windows 10 #соковыжималка endever sigma 75 #мини печь first fa 5045 2st

Подпишитесь на новые товары в dekostile.ru